Lineage for d5d7ia2 (5d7i A:179-269)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2352459Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2352460Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2365354Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2365355Protein automated matches [190740] (29 species)
    not a true protein
  7. 2365565Species Human (Homo sapiens) [TaxId:9606] [187920] (1626 PDB entries)
  8. 2366900Domain d5d7ia2: 5d7i A:179-269 [313336]
    Other proteins in same PDB: d5d7ia1, d5d7ib_, d5d7ic1, d5d7id_, d5d7ie2, d5d7ig2
    automated match to d4l4va2
    complexed with 30w, gol, pro

Details for d5d7ia2

PDB Entry: 5d7i (more details), 2 Å

PDB Description: structure of human mr1-ac-6-fp in complex with human mait m33.64 tcr
PDB Compounds: (A:) Major histocompatibility complex class I-related gene protein

SCOPe Domain Sequences for d5d7ia2:

Sequence, based on SEQRES records: (download)

>d5d7ia2 b.1.1.0 (A:179-269) automated matches {Human (Homo sapiens) [TaxId: 9606]}
tepplvrvnrketfpgvtalfckahgfyppeiymtwmkngeeivqeidygdilpsgdgty
qawasieldpqssnlyschvehsgvhmvlqv

Sequence, based on observed residues (ATOM records): (download)

>d5d7ia2 b.1.1.0 (A:179-269) automated matches {Human (Homo sapiens) [TaxId: 9606]}
tepplvrvnrketfpgvtalfckahgfyppeiymtwmkngeeivqeidygdilpsgdgty
qawasiellyschvehsgvhmvlqv

SCOPe Domain Coordinates for d5d7ia2:

Click to download the PDB-style file with coordinates for d5d7ia2.
(The format of our PDB-style files is described here.)

Timeline for d5d7ia2: