Lineage for d1cux__ (1cux -)

  1. Root: SCOP 1.67
  2. 383641Class c: Alpha and beta proteins (a/b) [51349] (130 folds)
  3. 400671Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest
  4. 400672Superfamily c.69.1: alpha/beta-Hydrolases [53474] (30 families) (S)
    many members have left-handed crossover connection between strand 8 and additional strand 9
  5. 401289Family c.69.1.30: Cutinase-like [52260] (2 proteins)
    minimal alpha/beta hydrolase lacking peripheral secondary structures; similar to a flavodoxin-like fold
  6. 401298Protein Cutinase [52261] (1 species)
  7. 401299Species Fungus (Fusarium solani), subsp. pisi [TaxId:169388] [52262] (39 PDB entries)
  8. 401323Domain d1cux__: 1cux - [31306]
    mutant

Details for d1cux__

PDB Entry: 1cux (more details), 1.75 Å

PDB Description: cutinase, l114y mutant

SCOP Domain Sequences for d1cux__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1cux__ c.69.1.30 (-) Cutinase {Fungus (Fusarium solani), subsp. pisi}
rttrddlingnsascadvifiyargstetgnlgtlgpsiasnlesafgkdgvwiqgvgga
yratlgdnalprgtssaairemlglfqqantkcpdatyiaggysqgaalaaasiedldsa
irdkiagtvlfgytknlqnrgripnypadrtkvfcntgdlvctgslivaaphlaygpdar
gpapefliekvravrgs

SCOP Domain Coordinates for d1cux__:

Click to download the PDB-style file with coordinates for d1cux__.
(The format of our PDB-style files is described here.)

Timeline for d1cux__: