SCOPe 2.07: Domain d5cz5f_: 5cz5 F:

Lineage for d5cz5f_ (5cz5 F:)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
   4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing

4. Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families)
   N-terminal residue provides two catalytic groups, nucleophile and proton donor

5. Family d.153.1.4: Proteasome subunits [56251] (4 proteins)

6. Protein automated matches [190144] (14 species)
   not a true protein

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [189752] (203 PDB entries)

8. Domain d5cz5f_: 5cz5 F: [312934]
   Other proteins in same PDB: d5cz5a_, d5cz5e_, d5cz5g_, d5cz5i_, d5cz5j_, d5cz5k_, d5cz5l_, d5cz5n_, d5cz5o_, d5cz5s_, d5cz5u_, d5cz5w_, d5cz5x_, d5cz5y_, d5cz5z_
   automated match to d4g4sg_
   complexed with 3bv, cl, mes, mg; mutant

Details for d5cz5f_

PDB Entry: 5cz5, 2.8 Å

PDB Description: yeast 20s proteasome beta1-t1a mutant in complex with carfilzomib

PDB Compounds: (F:) probable proteasome subunit alpha type-7

SCOPe Domain Sequences for d5cz5f_:

Sequence; same for both SEQRES and ATOM records:

>d5cz5f_ d.153.1.4 (F:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
tgydlsnsvfspdgrnfqveyavkavengttsigikcndgvvfaveklitskllvpqknv
kiqvvdrhigcvysglipdgrhlvnrgreeaasfkklyktpipipafadrlgqyvqahtl
ynsvrpfgvstifggvdkngahlymlepsgsywgykgaatgkgrqsakaeleklvdhhpe
glsareavkqaakiiylahednkekdfeleiswcslsetnglhkfvkgdllqeaidfaqk
ein

Timeline for d5cz5f_:

• d5cz5f_ first appeared in SCOPe 2.06
  
• d5cz5f_ appears in the current release, SCOPe 2.08