Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.5: RNase A-like [54075] (1 superfamily) contains long curved beta-sheet and 3 helices |
Superfamily d.5.1: RNase A-like [54076] (2 families) can be classified as disulfide-rich |
Family d.5.1.1: Ribonuclease A-like [54077] (9 proteins) |
Protein automated matches [190061] (7 species) not a true protein |
Species Pig (Sus scrofa) [TaxId:9823] [312520] (3 PDB entries) |
Domain d5arjb_: 5arj B: [312731] Other proteins in same PDB: d5arja2, d5arjc2, d5arjd2 automated match to d2rnfa_ mutant |
PDB Entry: 5arj (more details), 2.9 Å
SCOPe Domain Sequences for d5arjb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5arjb_ d.5.1.1 (B:) automated matches {Pig (Sus scrofa) [TaxId: 9823]} qdrmyqrflrqhvdpdatggndaycnlmmqrrkmtshyckrfntfihediwnirsicsts niqckngqmnchegvvkvtacretgssrapncryramastrrvviacegnpevpvhfdk
Timeline for d5arjb_: