Class b: All beta proteins [48724] (180 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.18: E set domains [81296] (27 families) "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies |
Family b.1.18.0: automated matches [191341] (1 protein) not a true family |
Protein automated matches [190226] (81 species) not a true protein |
Species Dengue virus 4 dominica/814669/1981 [TaxId:408871] [312577] (1 PDB entry) |
Domain d5b1cb_: 5b1c B: [312625] Other proteins in same PDB: d5b1ca2 automated match to d2h0pa_ complexed with so4; mutant |
PDB Entry: 5b1c (more details), 2 Å
SCOPe Domain Sequences for d5b1cb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5b1cb_ b.1.18.0 (B:) automated matches {Dengue virus 4 dominica/814669/1981 [TaxId: 408871]} ytmcsgkfsidkemaetqhgttvvkvkyegagapckvpieirdvnkekvvgriisstpla entnsvtnieleppfgdsyivigvgnsaltihwfrkg
Timeline for d5b1cb_: