SCOPe 2.08: Domain d5b1cb_: 5b1c B:

Lineage for d5b1cb_ (5b1c B:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.18: E set domains [81296] (27 families)
   "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies

5. Family b.1.18.0: automated matches [191341] (1 protein)
   not a true family

6. Protein automated matches [190226] (81 species)
   not a true protein

7. Species Dengue virus 4 dominica/814669/1981 [TaxId:408871] [312577] (1 PDB entry)

8. Domain d5b1cb_: 5b1c B: [312625]
   Other proteins in same PDB: d5b1ca2
   automated match to d2h0pa_
   complexed with so4; mutant

Details for d5b1cb_

PDB Entry: 5b1c, 2 Å

PDB Description: crystal structure of den4 ed3 mutant with l387i

PDB Compounds: (B:) Envelope protein E

SCOPe Domain Sequences for d5b1cb_:

Sequence; same for both SEQRES and ATOM records:

>d5b1cb_ b.1.18.0 (B:) automated matches {Dengue virus 4 dominica/814669/1981 [TaxId: 408871]}
ytmcsgkfsidkemaetqhgttvvkvkyegagapckvpieirdvnkekvvgriisstpla
entnsvtnieleppfgdsyivigvgnsaltihwfrkg

Timeline for d5b1cb_:

• d5b1cb_ first appeared in SCOPe 2.06
  
• d5b1cb_ appears in SCOPe 2.07