Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.129: TBP-like [55944] (11 superfamilies) beta-alpha-beta(4)-alpha |
Superfamily d.129.3: Bet v1-like [55961] (11 families) contains a single copy of this fold with a alpha-beta2 insertion after the first helix; there is a cavity between the beta-sheet and the long C-terminal helix |
Family d.129.3.0: automated matches [191339] (1 protein) not a true family |
Protein automated matches [190218] (22 species) not a true protein |
Species Burkholderia xenovorans [TaxId:266265] [226024] (9 PDB entries) |
Domain d5aews2: 5aew S:180-459 [312543] Other proteins in same PDB: d5aewa1, d5aewb_, d5aewc1, d5aewd_, d5aewe1, d5aewf_, d5aewg1, d5aewh_, d5aewi1, d5aewj_, d5aewk1, d5aewl_, d5aewm1, d5aewn_, d5aewo1, d5aewp_, d5aewq1, d5aewr_, d5aews1, d5aewt_, d5aewu1, d5aewv_, d5aeww1, d5aewx_ automated match to d2xr8a2 complexed with bnl, fe2, fes |
PDB Entry: 5aew (more details), 1.88 Å
SCOPe Domain Sequences for d5aews2:
Sequence; same for both SEQRES and ATOM records: (download)
>d5aews2 d.129.3.0 (S:180-459) automated matches {Burkholderia xenovorans [TaxId: 266265]} apdletylgdarpymdvmldrtpagtvaiggmqkwvipcnwkfaaeqfcsdmyhagttth lsgilagippemdlsqaqiptkgnqfraawgghgsgwyvdepgsllavmgpkvtqywteg paaelaeqrlghtgmpvrrmvgqhmtifptcsflpgintirtwhprgpneievwaftlvd adapaeikeeyrrhnirnfsaggvfeqddgenwveiqkglrgykaksqplnaqmglgrsq tghpdfpgnvgyvyaeeaargmyhhwmrmmsepswatlkp
Timeline for d5aews2:
View in 3D Domains from other chains: (mouse over for more information) d5aewa1, d5aewa2, d5aewb_, d5aewc1, d5aewc2, d5aewd_, d5aewe1, d5aewe2, d5aewf_, d5aewg1, d5aewg2, d5aewh_, d5aewi1, d5aewi2, d5aewj_, d5aewk1, d5aewk2, d5aewl_, d5aewm1, d5aewm2, d5aewn_, d5aewo1, d5aewo2, d5aewp_, d5aewq1, d5aewq2, d5aewr_, d5aewt_, d5aewu1, d5aewu2, d5aewv_, d5aeww1, d5aeww2, d5aewx_ |