Lineage for d5b0ba_ (5b0b A:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2555938Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2556580Superfamily d.58.4: Dimeric alpha+beta barrel [54909] (24 families) (S)
    dimerizes through the beta-sheet; forms beta-sheet barrel, closed (n=8, S=12); dimers may assemble in higher oligomers
  5. 2557030Family d.58.4.0: automated matches [191316] (1 protein)
    not a true family
  6. 2557031Protein automated matches [190081] (31 species)
    not a true protein
  7. 2557082Species Cannabis sativa [TaxId:3483] [312528] (9 PDB entries)
  8. 2557097Domain d5b0ba_: 5b0b A: [312532]
    automated match to d1q4ra_
    complexed with act; mutant

Details for d5b0ba_

PDB Entry: 5b0b (more details), 2.19 Å

PDB Description: polyketide cyclase oac from cannabis sativa, i7f mutant
PDB Compounds: (A:) Olivetolic acid cyclase

SCOPe Domain Sequences for d5b0ba_:

Sequence, based on SEQRES records: (download)

>d5b0ba_ d.58.4.0 (A:) automated matches {Cannabis sativa [TaxId: 3483]}
avkhlfvlkfkdeiteaqkeeffktyvnlvniipamkdvywgkdvtqknkeegythivev
tfesvetiqdyiihpahvgfgdvyrsfwekllifdytprk

Sequence, based on observed residues (ATOM records): (download)

>d5b0ba_ d.58.4.0 (A:) automated matches {Cannabis sativa [TaxId: 3483]}
avkhlfvlkfkdeiteaqkeeffktyvnlvniipamkdvywgkdgythivevtfesveti
qdyiihpahvgfgdvyrsfwekllifdytprk

SCOPe Domain Coordinates for d5b0ba_:

Click to download the PDB-style file with coordinates for d5b0ba_.
(The format of our PDB-style files is described here.)

Timeline for d5b0ba_: