Lineage for d4zhxf2 (4zhx F:183-325)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2550319Fold d.37: CBS-domain pair [54630] (1 superfamily)
    duplication: tandem repeat of two beta-X-beta-alpha-beta(2)-alpha motifs of similar sequences; 4 layers: a/b/b/a
  4. 2550320Superfamily d.37.1: CBS-domain pair [54631] (2 families) (S)
  5. 2550321Family d.37.1.1: CBS-domain pair [54632] (21 proteins)
    Pfam PF00571; pairs of CBS domains dimerize to form a stable globular domain, a.k.a. Bateman domain
  6. 2550322Protein 5'-AMP-activated protein kinase subunit gamma-1, AMPKg [160176] (1 species)
  7. 2550323Species Norway rat (Rattus norvegicus) [TaxId:10116] [160177] (15 PDB entries)
    Uniprot P80385 182-326! Uniprot P80385 23-181
  8. 2550361Domain d4zhxf2: 4zhx F:183-325 [312316]
    automated match to d2v8qe1
    complexed with 4o7, amp, c1v, c2z

Details for d4zhxf2

PDB Entry: 4zhx (more details), 2.99 Å

PDB Description: novel binding site for allosteric activation of ampk
PDB Compounds: (F:) 5'-amp-activated protein kinase subunit gamma-1

SCOPe Domain Sequences for d4zhxf2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4zhxf2 d.37.1.1 (F:183-325) 5'-AMP-activated protein kinase subunit gamma-1, AMPKg {Norway rat (Rattus norvegicus) [TaxId: 10116]}
fpkpefmsksleelqigtyaniamvrtttpvyvalgifvqhrvsalpvvdekgrvvdiys
kfdvinlaaektynnldvsvtkalqhrshyfegvlkcylhetletiinrlveaevhrlvv
vdendvvkgivslsdilqalvlt

SCOPe Domain Coordinates for d4zhxf2:

Click to download the PDB-style file with coordinates for d4zhxf2.
(The format of our PDB-style files is described here.)

Timeline for d4zhxf2:

View in 3D
Domains from same chain:
(mouse over for more information)
d4zhxf1