Class b: All beta proteins [48724] (178 folds) |
Fold b.6: Cupredoxin-like [49502] (2 superfamilies) sandwich; 7 strands in 2 sheets, greek-key variations: some members have additional 1-2 strands |
Superfamily b.6.1: Cupredoxins [49503] (8 families) contains copper-binding site |
Family b.6.1.0: automated matches [191502] (1 protein) not a true family |
Protein automated matches [190824] (29 species) not a true protein |
Species Alcaligenes faecalis [TaxId:511] [226762] (16 PDB entries) |
Domain d4ysec1: 4yse C:4-161 [312159] automated match to d1zdsa1 complexed with acy, cu, mpd |
PDB Entry: 4yse (more details), 1.2 Å
SCOPe Domain Sequences for d4ysec1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4ysec1 b.6.1.0 (C:4-161) automated matches {Alcaligenes faecalis [TaxId: 511]} ataaeiaalprqkvelvdppfvhahsqvaeggpkvveftmvieekkividdagtevhama fngtvpgplmvvhqddyleltlinpetntlmhnidfhaatgalgggglteinpgektilr fkatkpgvfvyhcappgmvpwhvvsgmngaimvlpreg
Timeline for d4ysec1:
View in 3D Domains from other chains: (mouse over for more information) d4ysea1, d4ysea2, d4yseb1, d4yseb2 |