Lineage for d4xbgb1 (4xbg B:1-106)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2352459Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2352460Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2352461Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2355068Protein automated matches [190119] (22 species)
    not a true protein
  7. 2355178Species Human (Homo sapiens) [TaxId:9606] [188740] (320 PDB entries)
  8. 2355674Domain d4xbgb1: 4xbg B:1-106 [312157]
    Other proteins in same PDB: d4xbgb2, d4xbgd2, d4xbgf2, d4xbgi2, d4xbgk2, d4xbgl2
    automated match to d1dn0a1
    complexed with 44e, gol, po4, unl

Details for d4xbgb1

PDB Entry: 4xbg (more details), 2.73 Å

PDB Description: crystal structure of human 4e10 fab in complex with phosphatidic acid (06:0 pa): 2.73 a resolution
PDB Compounds: (B:) 4E10 Fab light chain

SCOPe Domain Sequences for d4xbgb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4xbgb1 b.1.1.1 (B:1-106) automated matches {Human (Homo sapiens) [TaxId: 9606]}
eivltqspgtqslspgeratlscrasqsvgnnklawyqqrpgqaprlliygassrpsgva
drfsgsgsgtdftltisrlepedfavyycqqygqslstfgqgtkvev

SCOPe Domain Coordinates for d4xbgb1:

Click to download the PDB-style file with coordinates for d4xbgb1.
(The format of our PDB-style files is described here.)

Timeline for d4xbgb1: