![]() | Class b: All beta proteins [48724] (178 folds) |
![]() | Fold b.50: Acid proteases [50629] (1 superfamily) barrel, closed; n=6, S=10, complex topology |
![]() | Superfamily b.50.1: Acid proteases [50630] (4 families) ![]() |
![]() | Family b.50.1.2: Pepsin-like [50646] (11 proteins) duplication: consists of two similar barrel domains N-terminal: barrel, partly opened; n*=6, S*=10 |
![]() | Protein Endothiapepsin [50647] (1 species) |
![]() | Species Chestnut blight fungus (Endothia parasitica) [TaxId:5116] [50648] (538 PDB entries) |
![]() | Domain d4y3ma_: 4y3m A: [312114] automated match to d1oewa_ complexed with 45y, act, gol, peg, pge |
PDB Entry: 4y3m (more details), 1.55 Å
SCOPe Domain Sequences for d4y3ma_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4y3ma_ b.50.1.2 (A:) Endothiapepsin {Chestnut blight fungus (Endothia parasitica) [TaxId: 5116]} stgsatttpidslddayitpvqigtpaqtlnldfdtgssdlwvfssettasevdgqtiyt psksttakllsgatwsisygdgssssgdvytdtvsvggltvtgqavesakkvsssfteds tidgllglafstlntvsptqqktffdnakasldspvftadlgyhapgtynfgfidttayt gsitytavstkqgfwewtstgyavgsgtfkstsidgiadtgttllylpatvvsaywaqvs gakssssvggyvfpcsatlpsftfgvgsarivipgdyidfgpistgssscfggiqssagi ginifgdvalkaafvvfngattptlgfask
Timeline for d4y3ma_: