Class b: All beta proteins [48724] (178 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins) |
Protein automated matches [190119] (22 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [188740] (320 PDB entries) |
Domain d4xced1: 4xce D:1-106 [311860] Other proteins in same PDB: d4xceb2, d4xced2, d4xcel2 automated match to d1dn0a1 |
PDB Entry: 4xce (more details), 2.93 Å
SCOPe Domain Sequences for d4xced1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4xced1 b.1.1.1 (D:1-106) automated matches {Human (Homo sapiens) [TaxId: 9606]} eivltqspgtqslspgeratlscrasqsvgnnklawyqqrpgqaprlliygassrpsgva drfsgsgsgtdftltisrlepedfavyycqqygqslstfgqgtkvev
Timeline for d4xced1:
View in 3D Domains from other chains: (mouse over for more information) d4xceb1, d4xceb2, d4xcel1, d4xcel2 |