Lineage for d1azl__ (1azl -)
- Root: SCOP 1.57
Class c: Alpha and beta proteins (a/b) [51349] (107 folds) 
Fold c.23: Flavodoxin-like [52171] (17 superfamilies) 
Superfamily c.23.5: Flavoproteins [52218] (3 families) 
Family c.23.5.1: Flavodoxin-related [52219] (3 proteins) Protein Flavodoxin [52220] (6 species) Species Desulfovibrio vulgaris [TaxId:881] [52222] (20 PDB entries) 
Domain d1azl__: 1azl - [31154]
Details for d1azl__
PDB Entry: 1azl (more details), 1.8 Å
PDB Description: g61v flavodoxin mutant from desulfovibrio vulgaris
SCOP Domain Sequences for d1azl__:
Sequence; same for both SEQRES and ATOM records: (download)
>d1azl__ c.23.5.1 (-) Flavodoxin {Desulfovibrio vulgaris}
pkalivygsttgnteytaetiareladagyevdsrdaasveagglfegfdlvllgcstwv
ddsielqddfiplfdsleetgaqgrkvacfgcgdssyeyfcgavdaieeklknlgaeivq
dglridgdpraarddivgwahdvrgai
SCOP Domain Coordinates for d1azl__:
Click to download the PDB-style file with coordinates for d1azl__.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1azl__:
- d1azl__ first appeared (with stable ids) in SCOP 1.55
- d1azl__ appears in SCOP 1.59
- d1azl__ appears in the current release, SCOPe 2.08, called d1azla_
View in 3D