SCOP 1.61: Domain d1fyva_: 1fyv A:

Lineage for d1fyva_ (1fyv A:)

1. Root: SCOP 1.61

2. Class c: Alpha and beta proteins (a/b) [51349] (117 folds)

3. Fold c.23: Flavodoxin-like [52171] (16 superfamilies)

4. Superfamily c.23.2: Toll/Interleukin receptor TIR domain [52200] (1 family)

5. Family c.23.2.1: Toll/Interleukin receptor TIR domain [52201] (2 proteins)

6. Protein Toll-like receptor 1, TLR1 [52202] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [52203] (1 PDB entry)

8. Domain d1fyva_: 1fyv A: [31127]

Details for d1fyva_

PDB Entry: 1fyv, 2.9 Å

PDB Description: crystal structure of the tir domain of human tlr1

SCOP Domain Sequences for d1fyva_:

Sequence; same for both SEQRES and ATOM records:

>d1fyva_ c.23.2.1 (A:) Toll-like receptor 1, TLR1 {Human (Homo sapiens)}
nipleelqrnlqfhafisysghdsfwvknellpnlekegmqiclhernfvpgksivenii
tcieksyksifvlspnfvqsewchyelyfahhnlfhegsnslilillepipqysipssyh
klkslmarrtylewpkekskrglfwanlraainiklteqak

Timeline for d1fyva_:

• d1fyva_ first appeared (with stable ids) in SCOP 1.55
  
• d1fyva_ appears in SCOP 1.59
  
• d1fyva_ appears in SCOP 1.63
  
• d1fyva_ appears in the current release, SCOPe 2.08