Lineage for d1qo0e_ (1qo0 E:)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1586636Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 1586637Superfamily c.23.1: CheY-like [52172] (8 families) (S)
  5. 1586973Family c.23.1.3: Positive regulator of the amidase operon AmiR [52197] (1 protein)
  6. 1586974Protein Positive regulator of the amidase operon AmiR [52198] (1 species)
    contains coiled coil and small all-alpha subdomains in the C-terminal extension
  7. 1586975Species Pseudomonas aeruginosa [TaxId:287] [52199] (1 PDB entry)
  8. 1586977Domain d1qo0e_: 1qo0 E: [31126]
    Other proteins in same PDB: d1qo0a_, d1qo0b_
    complexed with bmd

Details for d1qo0e_

PDB Entry: 1qo0 (more details), 2.25 Å

PDB Description: amide receptor of the amidase operon of pseudomonas aeruginosa (amic) complexed with the negative regulator amir.
PDB Compounds: (E:) amir

SCOPe Domain Sequences for d1qo0e_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qo0e_ c.23.1.3 (E:) Positive regulator of the amidase operon AmiR {Pseudomonas aeruginosa [TaxId: 287]}
sansllgslrelqvlvlnppgevsdalvlqlirigcsvrqcwpppeafdvpvdvvftsif
qnrhhdeiaallaagtprttlvalveyespavlsqiielechgvitqpldahrvlpvlvs
arriseemaklkqkteqlqdriagqarinqakvllmqrhgwdereahqhlsreamkrrep
ilkiaqellgneps

SCOPe Domain Coordinates for d1qo0e_:

Click to download the PDB-style file with coordinates for d1qo0e_.
(The format of our PDB-style files is described here.)

Timeline for d1qo0e_: