SCOPe 2.03: Domain d1d5wa_: 1d5w A:

Lineage for d1d5wa_ (1d5w A:)

1. Root: SCOPe 2.03

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
   3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345

4. Superfamily c.23.1: CheY-like [52172] (8 families)

5. Family c.23.1.1: CheY-related [52173] (26 proteins)

6. Protein Transcriptional regulatory protein FixJ, receiver domain [52182] (1 species)

7. Species Rhizobium meliloti [TaxId:382] [52183] (4 PDB entries)

8. Domain d1d5wa_: 1d5w A: [31099]
   phosphorylated form
   complexed with so4

Details for d1d5wa_

PDB Entry: 1d5w, 2.3 Å

PDB Description: phosphorylated fixj receiver domain

PDB Compounds: (A:) transcriptional regulatory protein fixj

SCOPe Domain Sequences for d1d5wa_:

Sequence; same for both SEQRES and ATOM records:

>d1d5wa_ c.23.1.1 (A:) Transcriptional regulatory protein FixJ, receiver domain {Rhizobium meliloti [TaxId: 382]}
mqdytvhivddeepvrkslafmltmngfavkmhqsaeaflafapdvrngvlvtdlrmpdm
sgvellrnlgdlkinipsivitghgdvpmaveamkagavdfiekpfedtviieaierase
hlv

Timeline for d1d5wa_:

• d1d5wa_ first appeared (with stable ids) in SCOP 1.55
  
• d1d5wa_ appears in SCOPe 2.02
  
• d1d5wa_ appears in SCOPe 2.04
  
• d1d5wa_ appears in the current release, SCOPe 2.08