Lineage for d5f23a1 (5f23 A:1-275)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2468308Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
    core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145
  4. 2469527Superfamily c.26.2: Adenine nucleotide alpha hydrolases-like [52402] (7 families) (S)
    share similar mode of ligand (Adenosine group) binding
    can be subdivided into two group with closer relationships within each group than between the groups; the first three families form one group whereas the last two families form the other group
  5. 2469806Family c.26.2.0: automated matches [191320] (1 protein)
    not a true family
  6. 2469807Protein automated matches [190116] (28 species)
    not a true protein
  7. 2469913Species Pseudomonas aeruginosa, PA01 [TaxId:208964] [269193] (2 PDB entries)
  8. 2469914Domain d5f23a1: 5f23 A:1-275 [310532]
    Other proteins in same PDB: d5f23a2
    automated match to d4xfda_
    complexed with mes, nad

Details for d5f23a1

PDB Entry: 5f23 (more details), 1.5 Å

PDB Description: crystal structure of nh(3)-dependent nad(+) synthetase pseudomonas aeruginosa in complex with nad
PDB Compounds: (A:) nh(3)-dependent nad(+) synthetase

SCOPe Domain Sequences for d5f23a1:

Sequence, based on SEQRES records: (download)

>d5f23a1 c.26.2.0 (A:1-275) automated matches {Pseudomonas aeruginosa, PA01 [TaxId: 208964]}
mqqiqrdiaqalqvqppfqseadvqaqiarriafiqqclkdsglktlvlgisggvdslta
gllaqraveqlreqtgdqayrfiavrlpyqvqqdeadaqaslatiradeeqtvnigpsvk
alaeqlealeglepaksdfvignikarirmvaqyaiagargglvigtdhaaeavmgfftk
fgdgacdlaplsglakhqvralaralgapenlvekiptadledlrpghpdeashgvtyae
idaflhgqplreeaarvivdtyhktqhkrelpkap

Sequence, based on observed residues (ATOM records): (download)

>d5f23a1 c.26.2.0 (A:1-275) automated matches {Pseudomonas aeruginosa, PA01 [TaxId: 208964]}
mqqiqrdiaqalqvqppfqseadvqaqiarriafiqqclkdsglktlvlgisggvdslta
gllaqraveqlreqtgdqayrfiavrlpyqvqqdeadaqaslatiradeeqtvnigpsvk
alaeqlealeglepaksdfvignikarirmvaqyaiagargglvigtdhaaeavmgfftk
fgdgacdlaplsglakhqvralaralgapenlvekihgvtyaeidaflhgqplreeaarv
ivdtyhktqhkrelpkap

SCOPe Domain Coordinates for d5f23a1:

Click to download the PDB-style file with coordinates for d5f23a1.
(The format of our PDB-style files is described here.)

Timeline for d5f23a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d5f23a2