Lineage for d5ehfa3 (5ehf A:303-497)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2380192Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands
  4. 2380193Superfamily b.6.1: Cupredoxins [49503] (8 families) (S)
    contains copper-binding site
  5. 2381958Family b.6.1.0: automated matches [191502] (1 protein)
    not a true family
  6. 2381959Protein automated matches [190824] (29 species)
    not a true protein
  7. 2382080Species Antrodiella faginea [TaxId:92699] [277511] (1 PDB entry)
  8. 2382083Domain d5ehfa3: 5ehf A:303-497 [310504]
    automated match to d1gyca3
    complexed with cu, gol, nag, zn

Details for d5ehfa3

PDB Entry: 5ehf (more details), 1.75 Å

PDB Description: laccase from antrodiella faginea
PDB Compounds: (A:) laccase

SCOPe Domain Sequences for d5ehfa3:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ehfa3 b.6.1.0 (A:303-497) automated matches {Antrodiella faginea [TaxId: 92699]}
levnirpfvftpvpgqphaggadfvknllfsfngtnfqvdnvsfvpptvpillqilsgah
taqdlmpagsiiplpknaviefsmpggvvggghpihlhghnfwvirsanssvynyndpvi
rdvvnigttgdnvtirfetnnpgpwflhchidwhldlgfavvmaedipdaaaanpvpaaw
nelcplydaltpgnq

SCOPe Domain Coordinates for d5ehfa3:

Click to download the PDB-style file with coordinates for d5ehfa3.
(The format of our PDB-style files is described here.)

Timeline for d5ehfa3: