Lineage for d5e6ya1 (5e6y A:117-226)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2352459Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2375023Superfamily b.1.18: E set domains [81296] (24 families) (S)
    "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies
  5. 2376005Family b.1.18.0: automated matches [191341] (1 protein)
    not a true family
  6. 2376006Protein automated matches [190226] (72 species)
    not a true protein
  7. 2376125Species Escherichia coli [TaxId:331111] [311495] (3 PDB entries)
  8. 2376134Domain d5e6ya1: 5e6y A:117-226 [310445]
    Other proteins in same PDB: d5e6ya2, d5e6ya3, d5e6yb2, d5e6yb3, d5e6yc2, d5e6yc3, d5e6yd2, d5e6yd3
    automated match to d1m7xa1
    complexed with acx, gol

Details for d5e6ya1

PDB Entry: 5e6y (more details), 2.6 Å

PDB Description: crystal structure of e.coli branching enzyme in complex with alpha cyclodextrin
PDB Compounds: (A:) 1,4-alpha-glucan branching enzyme GlgB

SCOPe Domain Sequences for d5e6ya1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5e6ya1 b.1.18.0 (A:117-226) automated matches {Escherichia coli [TaxId: 331111]}
thlrpyetlgahadtmdgvtgtrfsvwapnarrvsvvgqfnywdgrrhpmrlrkesgiwe
lfipgahngqlykyemidangnlrlksdpyafeaqmrpetaslicglpek

SCOPe Domain Coordinates for d5e6ya1:

Click to download the PDB-style file with coordinates for d5e6ya1.
(The format of our PDB-style files is described here.)

Timeline for d5e6ya1: