Class b: All beta proteins [48724] (178 folds) |
Fold b.34: SH3-like barrel [50036] (21 superfamilies) barrel, partly opened; n*=4, S*=8; meander the last strand is interrupted by a turn of 3-10 helix |
Superfamily b.34.4: Electron transport accessory proteins [50090] (5 families) |
Family b.34.4.0: automated matches [191659] (1 protein) not a true family |
Protein automated matches [191237] (6 species) not a true protein |
Species Pea (Pisum sativum) [TaxId:3888] [311431] (7 PDB entries) |
Domain d4xk8e_: 4xk8 E: [310037] Other proteins in same PDB: d4xk81_, d4xk82_, d4xk83_, d4xk84_, d4xk86_, d4xk87_, d4xk88_, d4xk89_, d4xk8a_, d4xk8b_, d4xk8c_, d4xk8d_, d4xk8f_, d4xk8j_ automated match to d4y28e_ complexed with bcr, chl, cla, dgd, htg, lhg, lmg, lmt, lut, pqn, sf4, xat |
PDB Entry: 4xk8 (more details), 2.8 Å
SCOPe Domain Sequences for d4xk8e_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4xk8e_ b.34.4.0 (E:) automated matches {Pea (Pisum sativum) [TaxId: 3888]} gpkrgakvkilrkesywykgtgsvvavdqdpntrypvvvrfnkvnyanvstnnyaldeiq eve
Timeline for d4xk8e_: