Class b: All beta proteins [48724] (178 folds) |
Fold b.19: Viral protein domain [49817] (1 superfamily) sandwich; 9 strands in 2 sheets; jelly-roll; form trimers |
Superfamily b.19.1: Viral protein domain [49818] (4 families) forms homotrimers |
Family b.19.1.0: automated matches [227246] (1 protein) not a true family |
Protein automated matches [227017] (57 species) not a true protein |
Species Influenza A virus [TaxId:1392907] [311455] (1 PDB entry) |
Domain d4we7d1: 4we7 D:1-268 [309838] Other proteins in same PDB: d4we7a2, d4we7a3, d4we7b2, d4we7b3, d4we7c2, d4we7c3, d4we7d2, d4we7d3 automated match to d3s13a_ complexed with nag |
PDB Entry: 4we7 (more details), 2.5 Å
SCOPe Domain Sequences for d4we7d1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4we7d1 b.19.1.0 (D:1-268) automated matches {Influenza A virus [TaxId: 1392907]} elvqssstgeicnsphqildgenctlidallgdpqcdgfqnkkwdlfverskahsncypy dvpdyaslrslvassgtlefnnesfnwtgvtqngtssacirrsnnsffsrlnwlthlnfk ypalnvtmpnneqfdklyiwgvhhpgtdkdqiflyaqaagritvstkrsqqavipnvgsr prvrnipsrvsiywtivkpgdillinstgnliaprgyfkirsgkssimrsdapigkcnsa citpngsipndkpfqnvnritygacpry
Timeline for d4we7d1: