Lineage for d4r67r_ (4r67 r:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2594580Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 2594581Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 2594772Family d.153.1.4: Proteasome subunits [56251] (4 proteins)
  6. 2594884Protein Proteasome alpha subunit (non-catalytic) [56255] (10 species)
    contains an extension to the common fold at the N-terminus
  7. 2596997Species Human (Homo sapiens) [TaxId:9606] [311422] (14 PDB entries)
  8. 2597083Domain d4r67r_: 4r67 r: [309406]
    Other proteins in same PDB: d4r670_, d4r671_, d4r672_, d4r673_, d4r67c_, d4r67h_, d4r67i_, d4r67j_, d4r67k_, d4r67l_, d4r67m_, d4r67n_, d4r67q_, d4r67v_, d4r67w_, d4r67x_, d4r67y_, d4r67z_
    automated match to d1irub_
    complexed with 3bv

Details for d4r67r_

PDB Entry: 4r67 (more details), 2.89 Å

PDB Description: Human constitutive 20S proteasome in complex with carfilzomib
PDB Compounds: (r:) Proteasome subunit alpha type-2

SCOPe Domain Sequences for d4r67r_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4r67r_ d.153.1.4 (r:) Proteasome alpha subunit (non-catalytic) {Human (Homo sapiens) [TaxId: 9606]}
aergysfslttfspsgklvqieyalaavaggapsvgikaangvvlatekkqksilyders
vhkvepitkhiglvysgmgpdyrvlvhrarklaqqyylvyqepiptaqlvqrvasvmqey
tqsggvrpfgvsllicgwnegrpylfqsdpsgayfawkatamgknyvngktflekryned
leledaihtailtlkesfegqmtednievgicneagfrrltptevkdylaaia

SCOPe Domain Coordinates for d4r67r_:

Click to download the PDB-style file with coordinates for d4r67r_.
(The format of our PDB-style files is described here.)

Timeline for d4r67r_: