SCOPe 2.07: Domain d4qzzt_: 4qzz T:

Lineage for d4qzzt_ (4qzz T:)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
   4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing

4. Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families)
   N-terminal residue provides two catalytic groups, nucleophile and proton donor

5. Family d.153.1.4: Proteasome subunits [56251] (4 proteins)

6. Protein automated matches [190144] (14 species)
   not a true protein

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [189752] (203 PDB entries)

8. Domain d4qzzt_: 4qzz T: [309318]
   Other proteins in same PDB: d4qzza_, d4qzzc_, d4qzzd_, d4qzze_, d4qzzg_, d4qzzi_, d4qzzj_, d4qzzk_, d4qzzl_, d4qzzn_, d4qzzo_, d4qzzq_, d4qzzr_, d4qzzs_, d4qzzu_, d4qzzw_, d4qzzx_, d4qzzy_, d4qzzz_
   automated match to d4g4sg_
   complexed with cl, mg, sla

Details for d4qzzt_

PDB Entry: 4qzz, 2.9 Å

PDB Description: yCP in complex with Omuralide

PDB Compounds: (T:) probable proteasome subunit alpha type-7

SCOPe Domain Sequences for d4qzzt_:

Sequence; same for both SEQRES and ATOM records:

>d4qzzt_ d.153.1.4 (T:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
tgydlsnsvfspdgrnfqveyavkavengttsigikcndgvvfaveklitskllvpqknv
kiqvvdrhigcvysglipdgrhlvnrgreeaasfkklyktpipipafadrlgqyvqahtl
ynsvrpfgvstifggvdkngahlymlepsgsywgykgaatgkgrqsakaeleklvdhhpe
glsareavkqaakiiylahednkekdfeleiswcslsetnglhkfvkgdllqeaidfaqk
ein

Timeline for d4qzzt_:

• d4qzzt_ first appeared in SCOPe 2.06
  
• d4qzzt_ appears in the current release, SCOPe 2.08