SCOPe 2.08: Domain d1fqvo2: 1fqv O:146-431

Lineage for d1fqvo2 (1fqv O:146-431)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.10: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) [52046] (3 superfamilies)
   2 curved layers, a/b; parallel beta-sheet; order 1234...N; there are sequence similarities between different superfamilies

4. Superfamily c.10.1: RNI-like [52047] (4 families)
   regular structure consisting of similar repeats

5. Family c.10.1.3: Cyclin A/CDK2-associated p19, Skp2 [52055] (1 protein)
   this is a repeat family; one repeat unit is 1fqv C:251-227 found in domain

6. Protein Cyclin A/CDK2-associated p19, Skp2 [52056] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [52057] (4 PDB entries)

8. Domain d1fqvo2: 1fqv O:146-431 [30863]
   Other proteins in same PDB: d1fqva1, d1fqvb1, d1fqvb2, d1fqvc1, d1fqvd1, d1fqvd2, d1fqve1, d1fqvf1, d1fqvf2, d1fqvg1, d1fqvh1, d1fqvh2, d1fqvi1, d1fqvj1, d1fqvj2, d1fqvk1, d1fqvl1, d1fqvl2, d1fqvm1, d1fqvn1, d1fqvn2, d1fqvo1, d1fqvp1, d1fqvp2

Details for d1fqvo2

PDB Entry: 1fqv, 2.8 Å

PDB Description: Insights into scf ubiquitin ligases from the structure of the skp1-skp2 complex

PDB Compounds: (O:) skp2

SCOPe Domain Sequences for d1fqvo2:

Sequence; same for both SEQRES and ATOM records:

>d1fqvo2 c.10.1.3 (O:146-431) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]}
eslwqtldltgknlhpdvtgrllsqgviafrcprsfmdqplaehfspfrvqhmdlsnsvi
evstlhgilsqcsklqnlsleglrlsdpivntlaknsnlvrlnlsgcsgfsefalqtlls
scsrldelnlswcfdftekhvqvavahvsetitqlnlsgyrknlqksdlstlvrrcpnlv
hldlsdsvmlkndcfqeffqlnylqhlslsrcydiipetllelgeiptlktlqvfgivpd
gtlqllkealphlqincshfttiarptignkknqeiwgikcrltlq

Timeline for d1fqvo2:

• d1fqvo2 first appeared (with stable ids) in SCOP 1.55
  
• d1fqvo2 appears in SCOPe 2.07