SCOPe 2.07: Domain d4qvym_: 4qvy M:

Lineage for d4qvym_ (4qvy M:)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
   4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing

4. Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families)
   N-terminal residue provides two catalytic groups, nucleophile and proton donor

5. Family d.153.1.4: Proteasome subunits [56251] (4 proteins)

6. Protein automated matches [190144] (14 species)
   not a true protein

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [189752] (203 PDB entries)

8. Domain d4qvym_: 4qvy M: [308604]
   Other proteins in same PDB: d4qvya_, d4qvyc_, d4qvyd_, d4qvye_, d4qvyg_, d4qvyi_, d4qvyj_, d4qvyk_, d4qvyl_, d4qvyn_, d4qvyo_, d4qvyq_, d4qvyr_, d4qvys_, d4qvyu_, d4qvyw_, d4qvyx_, d4qvyy_, d4qvyz_
   automated match to d4j70m_
   complexed with bo2, cl, mg; mutant

Details for d4qvym_

PDB Entry: 4qvy, 2.51 Å

PDB Description: yCP beta5-A49T-mutant in complex with bortezomib

PDB Compounds: (M:) Proteasome subunit beta type-7

SCOPe Domain Sequences for d4qvym_:

Sequence; same for both SEQRES and ATOM records:

>d4qvym_ d.153.1.4 (M:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
tqqpivtgtsvismkydngviiaadnlgsygsllrfngverlipvgdntvvgisgdisdm
qhierllkdlvtenaydnpladaeealepsyifeylatvmyqrrskmnplwnaiivagvq
sngdqflryvnllgvtyssptlatgfgahmanpllrkvvdresdipkttvqvaeeaivna
mrvlyyrdarssrnfslaiidkntgltfkknlqvenmkwdfakdikgygtqki

Timeline for d4qvym_:

• d4qvym_ first appeared in SCOPe 2.06
  
• d4qvym_ appears in the current release, SCOPe 2.08