SCOPe 2.07: Domain d4qvwb_: 4qvw B:

Lineage for d4qvwb_ (4qvw B:)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
   4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing

4. Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families)
   N-terminal residue provides two catalytic groups, nucleophile and proton donor

5. Family d.153.1.4: Proteasome subunits [56251] (4 proteins)

6. Protein automated matches [190144] (14 species)
   not a true protein

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [189752] (203 PDB entries)

8. Domain d4qvwb_: 4qvw B: [308570]
   Other proteins in same PDB: d4qvwa_, d4qvwc_, d4qvwe_, d4qvwi_, d4qvwj_, d4qvwk_, d4qvwl_, d4qvwn_, d4qvwo_, d4qvwq_, d4qvws_, d4qvww_, d4qvwx_, d4qvwy_, d4qvwz_
   automated match to d1rypc_
   complexed with bo2, cl, mg; mutant

Details for d4qvwb_

PDB Entry: 4qvw, 3 Å

PDB Description: yCP beta5-A49S-mutant in complex with bortezomib

PDB Compounds: (B:) Proteasome subunit alpha type-3

SCOPe Domain Sequences for d4qvwb_:

Sequence; same for both SEQRES and ATOM records:

>d4qvwb_ d.153.1.4 (B:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
gsrrydsrttifspegrlyqveyalesishagtaigimasdgivlaaerkvtstlleqdt
steklyklndkiavavagltadaeilintarihaqnylktynedipveilvrrlsdikqg
ytqhgglrpfgvsfiyagyddrygyqlytsnpsgnytgwkaisvgantsaaqtllqmdyk
ddmkvddaielalktlskttdssaltydrlefatirkgandgevyqkifkpqeikdilvk
tgit

Timeline for d4qvwb_:

• d4qvwb_ first appeared in SCOPe 2.06
  
• d4qvwb_ appears in the current release, SCOPe 2.08