Lineage for d1yrgb_ (1yrg B:)

  1. Root: SCOP 1.59
  2. 115903Class c: Alpha and beta proteins (a/b) [51349] (113 folds)
  3. 119773Fold c.10: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) [52046] (2 superfamilies)
  4. 119774Superfamily c.10.1: RNI-like [52047] (3 families) (S)
  5. 119783Family c.10.1.2: Rna1p (RanGAP1), N-terminal domain [52052] (1 protein)
    this is a repeat family; one repeat unit is 1k5d C:168-196 found in domain
  6. 119784Protein Rna1p (RanGAP1), N-terminal domain [52053] (1 species)
  7. 119785Species Fission yeast (Schizosaccharomyces pombe) [TaxId:4896] [52054] (3 PDB entries)
  8. 119787Domain d1yrgb_: 1yrg B: [30855]

Details for d1yrgb_

PDB Entry: 1yrg (more details), 2.66 Å

PDB Description: the crystal structure of rna1p: a new fold for a gtpase-activating protein

SCOP Domain Sequences for d1yrgb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1yrgb_ c.10.1.2 (B:) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe)}
arfsiegkslkldaittedeksvfavlleddsvkeivlsgntigteaarwlseniaskkd
leiaefsdiftgrvkdeipealrlllqallkcpklhtvrlsdnafgptaqeplidflskh
tplehlylhnnglgpqagakiaralqelavnkkaknapplrsiicgrnrlengsmkewak
tfqshrllhtvkmvqngirpegiehllleglaycqelkvldlqdntfthlgssalaialk
swpnlrelglndcllsargaaavvdafskleniglqtlrlqyneieldavrtlktvidek
mpdllflelngnrfseeddvvdeirevfstrgrgeldelddme

SCOP Domain Coordinates for d1yrgb_:

Click to download the PDB-style file with coordinates for d1yrgb_.
(The format of our PDB-style files is described here.)

Timeline for d1yrgb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1yrga_