SCOP 1.63: Domain d1b3sd_: 1b3s D:

Lineage for d1b3sd_ (1b3s D:)

1. Root: SCOP 1.63

2. Class c: Alpha and beta proteins (a/b) [51349] (117 folds)

3. Fold c.9: Barstar-like [52037] (2 superfamilies)
   2 layers, a/b; parallel beta-sheet of 3 strands, order 123

4. Superfamily c.9.1: Barstar (barnase inhibitor) [52038] (1 family)

5. Family c.9.1.1: Barstar (barnase inhibitor) [52039] (1 protein)

6. Protein Barstar (barnase inhibitor) [52040] (1 species)

7. Species Bacillus amyloliquefaciens [TaxId:1390] [52041] (11 PDB entries)

8. Domain d1b3sd_: 1b3s D: [30846]
   Other proteins in same PDB: d1b3sa_, d1b3sb_, d1b3sc_

Details for d1b3sd_

PDB Entry: 1b3s, 2.39 Å

PDB Description: structural response to mutation at a protein-protein interface

SCOP Domain Sequences for d1b3sd_:

Sequence; same for both SEQRES and ATOM records:

>d1b3sd_ c.9.1.1 (D:) Barstar (barnase inhibitor) {Bacillus amyloliquefaciens}
mkkavingeqirsisdlhqtlkkelalpefygenldalwdcltgwveyplvlewrqfeqs
kqltengaesvlqvfreakaegcditiils

Timeline for d1b3sd_:

• d1b3sd_ first appeared (with stable ids) in SCOP 1.55
  
• d1b3sd_ appears in SCOP 1.61
  
• d1b3sd_ appears in SCOP 1.65
  
• d1b3sd_ appears in the current release, SCOPe 2.08