Lineage for d1bta__ (1bta -)

  1. Root: SCOP 1.65
  2. 305035Class c: Alpha and beta proteins (a/b) [51349] (121 folds)
  3. 310311Fold c.9: Barstar-like [52037] (2 superfamilies)
    2 layers, a/b; parallel beta-sheet of 3 strands, order 123
  4. 310312Superfamily c.9.1: Barstar (barnase inhibitor) [52038] (1 family) (S)
  5. 310313Family c.9.1.1: Barstar (barnase inhibitor) [52039] (1 protein)
  6. 310314Protein Barstar (barnase inhibitor) [52040] (1 species)
  7. 310315Species Bacillus amyloliquefaciens [TaxId:1390] [52041] (11 PDB entries)
  8. 310337Domain d1bta__: 1bta - [30833]

Details for d1bta__

PDB Entry: 1bta (more details)

PDB Description: three-dimensional solution structure and 13c assignments of barstar using nuclear magnetic resonance spectroscopy

SCOP Domain Sequences for d1bta__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bta__ c.9.1.1 (-) Barstar (barnase inhibitor) {Bacillus amyloliquefaciens}
kkavingeqirsisdlhqtlkkelalpeyygenldalwdcltgwveyplvlewrqfeqsk
qltengaesvlqvfreakaegcditiils

SCOP Domain Coordinates for d1bta__:

Click to download the PDB-style file with coordinates for d1bta__.
(The format of our PDB-style files is described here.)

Timeline for d1bta__: