SCOPe 2.07: Domain d4qv3g_: 4qv3 G:

Lineage for d4qv3g_ (4qv3 G:)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
   4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing

4. Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families)
   N-terminal residue provides two catalytic groups, nucleophile and proton donor

5. Family d.153.1.4: Proteasome subunits [56251] (4 proteins)

6. Protein automated matches [190144] (14 species)
   not a true protein

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [189752] (203 PDB entries)

8. Domain d4qv3g_: 4qv3 G: [308262]
   Other proteins in same PDB: d4qv3a_, d4qv3c_, d4qv3e_, d4qv3i_, d4qv3j_, d4qv3k_, d4qv3l_, d4qv3n_, d4qv3o_, d4qv3q_, d4qv3s_, d4qv3w_, d4qv3x_, d4qv3y_, d4qv3z_
   automated match to d1rypa_
   complexed with cl, mg; mutant

Details for d4qv3g_

PDB Entry: 4qv3, 3 Å

PDB Description: yCP beta5-M45V mutant

PDB Compounds: (G:) Proteasome subunit alpha type-1

SCOPe Domain Sequences for d4qv3g_:

Sequence; same for both SEQRES and ATOM records:

>d4qv3g_ d.153.1.4 (G:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
gydrhitifspegrlyqveyafkatnqtninslavrgkdctvvisqkkvpdklldpttvs
yifcisrtigmvvngpipdarnaalrakaeaaefrykygydmpcdvlakrmanlsqiytq
raymrplgviltfvsvdeelgpsiyktdpagyyvgykatatgpkqqeittnlenhfkksk
idhineeswekvvefaithmidalgtefskndlevgvatkdkfftlsaenieerlvaiae
q

Timeline for d4qv3g_:

• d4qv3g_ first appeared in SCOPe 2.06
  
• d4qv3g_ appears in the current release, SCOPe 2.08