Lineage for d1jdbi1 (1jdb I:2-152)

  1. Root: SCOP 1.65
  2. 305035Class c: Alpha and beta proteins (a/b) [51349] (121 folds)
  3. 310107Fold c.8: The "swivelling" beta/beta/alpha domain [52008] (7 superfamilies)
    3 layers: b/b/a; the central sheet is parallel, and the other one is antiparallel; there are some variations in topology
    this domain is thought to be mobile in all proteins known to contain it
  4. 310159Superfamily c.8.3: Carbamoyl phosphate synthetase, small subunit N-terminal domain [52021] (1 family) (S)
  5. 310160Family c.8.3.1: Carbamoyl phosphate synthetase, small subunit N-terminal domain [52022] (1 protein)
  6. 310161Protein Carbamoyl phosphate synthetase, small subunit N-terminal domain [52023] (1 species)
  7. 310162Species Escherichia coli [TaxId:562] [52024] (9 PDB entries)
  8. 310177Domain d1jdbi1: 1jdb I:2-152 [30758]
    Other proteins in same PDB: d1jdbb1, d1jdbb2, d1jdbb3, d1jdbb4, d1jdbb5, d1jdbb6, d1jdbc2, d1jdbe1, d1jdbe2, d1jdbe3, d1jdbe4, d1jdbe5, d1jdbe6, d1jdbf2, d1jdbh1, d1jdbh2, d1jdbh3, d1jdbh4, d1jdbh5, d1jdbh6, d1jdbi2, d1jdbk1, d1jdbk2, d1jdbk3, d1jdbk4, d1jdbk5, d1jdbk6, d1jdbl2

Details for d1jdbi1

PDB Entry: 1jdb (more details), 2.1 Å

PDB Description: carbamoyl phosphate synthetase from escherichia coli

SCOP Domain Sequences for d1jdbi1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jdbi1 c.8.3.1 (I:2-152) Carbamoyl phosphate synthetase, small subunit N-terminal domain {Escherichia coli}
iksallvledgtqfhgraigatgsavgevvfntsmtgyqeiltdpsysrqivtltyphig
nvgtndadeessqvhaqglvirdlpliasnfrntedlssylkrhnivaiadidtrkltrl
lrekgaqngciiagdnpdaalalekarafpg

SCOP Domain Coordinates for d1jdbi1:

Click to download the PDB-style file with coordinates for d1jdbi1.
(The format of our PDB-style files is described here.)

Timeline for d1jdbi1: