Lineage for d1c3ob1 (1c3o B:2-152)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 21274Fold c.8: The "swivelling" beta/beta/alpha domain [52008] (5 superfamilies)
  4. 21317Superfamily c.8.3: Carbamoyl phosphate synthetase, small subunit N-terminal domain [52021] (1 family) (S)
  5. 21318Family c.8.3.1: Carbamoyl phosphate synthetase, small subunit N-terminal domain [52022] (1 protein)
  6. 21319Protein Carbamoyl phosphate synthetase, small subunit N-terminal domain [52023] (1 species)
  7. 21320Species Escherichia coli [TaxId:562] [52024] (7 PDB entries)
  8. 21333Domain d1c3ob1: 1c3o B:2-152 [30744]
    Other proteins in same PDB: d1c3oa1, d1c3oa2, d1c3oa3, d1c3oa4, d1c3oa5, d1c3oa6, d1c3ob2, d1c3oc1, d1c3oc2, d1c3oc3, d1c3oc4, d1c3oc5, d1c3oc6, d1c3od2, d1c3oe1, d1c3oe2, d1c3oe3, d1c3oe4, d1c3oe5, d1c3oe6, d1c3of2, d1c3og1, d1c3og2, d1c3og3, d1c3og4, d1c3og5, d1c3og6, d1c3oh2

Details for d1c3ob1

PDB Entry: 1c3o (more details), 2.1 Å

PDB Description: crystal structure of the carbamoyl phosphate synthetase: small subunit mutant c269s with bound glutamine

SCOP Domain Sequences for d1c3ob1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1c3ob1 c.8.3.1 (B:2-152) Carbamoyl phosphate synthetase, small subunit N-terminal domain {Escherichia coli}
iksallvledgtqfhgraigatgsavgevvfntsmtgyqeiltdpsysrqivtltyphig
nvgtndadeessqvhaqglvirdlpliasnfrntedlssylkrhnivaiadidtrkltrl
lrekgaqngciiagdnpdaalalekarafpg

SCOP Domain Coordinates for d1c3ob1:

Click to download the PDB-style file with coordinates for d1c3ob1.
(The format of our PDB-style files is described here.)

Timeline for d1c3ob1: