Lineage for d4e33a_ (4e33 A:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2500487Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest
  4. 2500488Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (60 families) (S)
  5. 2502076Family c.66.1.60: C-3'-methyltransferase-like [310657] (2 proteins)
    Pfam PF08421; Pfam PF13489; Pfam PF08484 (in that order in the sequence)
  6. 2502077Protein TcaB9 [310820] (1 species)
  7. 2502078Species Micromonospora chalcea [TaxId:1874] [311087] (10 PDB entries)
  8. 2502086Domain d4e33a_: 4e33 A: [307278]
    automated match to d3ndja_
    complexed with 0n2, sah, zn

Details for d4e33a_

PDB Entry: 4e33 (more details), 1.6 Å

PDB Description: X-ray Structure of the C-3'-Methyltransferase TcaB9 in Complex with S-Adenosyl-L-Homocysteine and Reduced dTDP-Sugar Substrate
PDB Compounds: (A:) TcaB9

SCOPe Domain Sequences for d4e33a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4e33a_ c.66.1.60 (A:) TcaB9 {Micromonospora chalcea [TaxId: 1874]}
tacrvcgggvqefldlgrqplsdrfrkpdelddeftyrlavgrcdscemvqlteevprdl
mfhevypyhssgssvmrehfamlardflateltgpdpfiveigcndgimlrtiqeagvrh
lgfepssgvaakarekgirvrtdffekataddvrrtegpanviyaantlchipyvqsvle
gvdallapdgvfvfedpylgdivaktsfdqiydehfflfsatsvqgmaqrcgfelvdvqr
lpvhggevrytlarqgsrtpsaavaqllaaereqelsdmatlrafagnvvkirdeltall
hrlraegrsvvgygataksatvtnfcgigpdlvhsvydttpdkqnrltpgahipvrpasa
fsdpypdyallfawnhaeeimakeqefhqaggrwilyvpevhir

SCOPe Domain Coordinates for d4e33a_:

Click to download the PDB-style file with coordinates for d4e33a_.
(The format of our PDB-style files is described here.)

Timeline for d4e33a_: