Lineage for d4d6ga1 (4d6g A:421-838)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2473887Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2473888Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2479613Family c.37.1.0: automated matches [191323] (1 protein)
    not a true family
  6. 2479614Protein automated matches [190123] (156 species)
    not a true protein
  7. 2480937Species Streptococcus pneumoniae [TaxId:406556] [311248] (13 PDB entries)
  8. 2480938Domain d4d6ga1: 4d6g A:421-838 [307221]
    Other proteins in same PDB: d4d6ga2, d4d6ga3
    automated match to d2wmfa1
    complexed with edo; mutant

Details for d4d6ga1

PDB Entry: 4d6g (more details), 1.24 Å

PDB Description: crystal structure of a family 98 glycoside hydrolase catalytic module (sp3gh98) in complex with the blood group a-trisaccharide (l19 mutant)
PDB Compounds: (A:) glycoside hydrolase

SCOPe Domain Sequences for d4d6ga1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4d6ga1 c.37.1.0 (A:421-838) automated matches {Streptococcus pneumoniae [TaxId: 406556]}
evdkrreinnehpllmmplyangeefnqgkytfwggdtltgkwenipddlkpytviqlhp
ddlpkrdgaardfyehmleeaakyvnpktgknepipviltvytagnmpyhtsahwlstsw
idkmyqkypnlhgifstesywiwandienkaadylkvsaknggyfiwaeqnsgsaiekaf
gkngkiafqksvdkywknlifmfkntpaaegndsttesymkglwlsnhtyqwgglmdtwk
wyetgkwklfasgnigksqgdrqwltepesmlgeealgvylnggvvynfehpaytygvnn
kesllfsevikeffryviahpapskekvledtkvfihgdysnkgngkffvnvntdreqtp
lymtgrynvipaipgvlktdklkesvsssriqikeitspefsstqarkeylnklypmn

SCOPe Domain Coordinates for d4d6ga1:

Click to download the PDB-style file with coordinates for d4d6ga1.
(The format of our PDB-style files is described here.)

Timeline for d4d6ga1: