Class b: All beta proteins [48724] (178 folds) |
Fold b.61: Streptavidin-like [50875] (8 superfamilies) barrel, closed; n=8, S=10; meander |
Superfamily b.61.1: Avidin/streptavidin [50876] (2 families) |
Family b.61.1.1: Avidin/streptavidin [50877] (3 proteins) |
Protein automated matches [190191] (2 species) not a true protein |
Species Streptomyces avidinii [TaxId:1895] [189343] (98 PDB entries) |
Domain d3wzqb1: 3wzq B:13-135 [306962] Other proteins in same PDB: d3wzqa2, d3wzqb2, d3wzqc2, d3wzqd2 automated match to d4ekva_ complexed with p6g, zof; mutant |
PDB Entry: 3wzq (more details), 1.7 Å
SCOPe Domain Sequences for d3wzqb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3wzqb1 b.61.1.1 (B:13-135) automated matches {Streptomyces avidinii [TaxId: 1895]} aeagitgtwsdqlgdtfivtagadgaltgtyenavgnaesryvltgrydsapatdgsgta lgwtvawknnsknahsattwsgqyvggadakintqwlltsgttnanawkstlvghdtftk vkp
Timeline for d3wzqb1: