Lineage for d3vr6f2 (3vr6 F:76-351)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2473887Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2473888Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2479613Family c.37.1.0: automated matches [191323] (1 protein)
    not a true family
  6. 2479614Protein automated matches [190123] (156 species)
    not a true protein
  7. 2479900Species Enterococcus hirae [TaxId:1354] [311346] (3 PDB entries)
  8. 2479909Domain d3vr6f2: 3vr6 F:76-351 [306713]
    Other proteins in same PDB: d3vr6d1, d3vr6d3, d3vr6e1, d3vr6e3, d3vr6f1, d3vr6f3, d3vr6g1, d3vr6g2
    automated match to d3gqbb2
    complexed with anp, mg

Details for d3vr6f2

PDB Entry: 3vr6 (more details), 2.68 Å

PDB Description: crystal structure of amp-pnp bound enterococcus hirae v1-atpase [bv1]
PDB Compounds: (F:) V-type sodium ATPase subunit B

SCOPe Domain Sequences for d3vr6f2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3vr6f2 c.37.1.0 (F:76-351) automated matches {Enterococcus hirae [TaxId: 1354]}
plqlgvsedmigrvfdglgrpkdngpeilpekyldingevinpiardypdefiqtgisai
dhlntlvrgqklpvfsgsglphkelaaqiarqatvldssddfavvfaaigitfeeaeffm
edfrqtgaidrsvmfmnlandpaieriatprmaltaaeylayekgmhvlvimtdmtnyae
alreisaarrevpgrrgypgylytnlatlferagrirglkgsvtqipiltmpeddkthpi
pdltgyitegqiiltrelyksgiqppidvlpslsrl

SCOPe Domain Coordinates for d3vr6f2:

Click to download the PDB-style file with coordinates for d3vr6f2.
(The format of our PDB-style files is described here.)

Timeline for d3vr6f2: