Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) division into families based on beta-sheet topologies |
Family c.37.1.0: automated matches [191323] (1 protein) not a true family |
Protein automated matches [190123] (156 species) not a true protein |
Species Enterococcus hirae [TaxId:1354] [311346] (3 PDB entries) |
Domain d3vr6f2: 3vr6 F:76-351 [306713] Other proteins in same PDB: d3vr6d1, d3vr6d3, d3vr6e1, d3vr6e3, d3vr6f1, d3vr6f3, d3vr6g1, d3vr6g2 automated match to d3gqbb2 complexed with anp, mg |
PDB Entry: 3vr6 (more details), 2.68 Å
SCOPe Domain Sequences for d3vr6f2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3vr6f2 c.37.1.0 (F:76-351) automated matches {Enterococcus hirae [TaxId: 1354]} plqlgvsedmigrvfdglgrpkdngpeilpekyldingevinpiardypdefiqtgisai dhlntlvrgqklpvfsgsglphkelaaqiarqatvldssddfavvfaaigitfeeaeffm edfrqtgaidrsvmfmnlandpaieriatprmaltaaeylayekgmhvlvimtdmtnyae alreisaarrevpgrrgypgylytnlatlferagrirglkgsvtqipiltmpeddkthpi pdltgyitegqiiltrelyksgiqppidvlpslsrl
Timeline for d3vr6f2: