Class b: All beta proteins [48724] (178 folds) |
Fold b.49: Domain of alpha and beta subunits of F1 ATP synthase-like [50614] (4 superfamilies) barrel, closed; n=6, S=8; greek-key Many cradle-loop superfamilies may be homologous, according to PubMed 18457946 |
Superfamily b.49.1: N-terminal domain of alpha and beta (or A/B) subunits of rotary ATPases [50615] (3 families) automatically mapped to Pfam PF02874 |
Family b.49.1.0: automated matches [254232] (1 protein) not a true family |
Protein automated matches [254527] (17 species) not a true protein |
Species Methanosarcina mazei [TaxId:192952] [311341] (3 PDB entries) |
Domain d3tiva1: 3tiv A:12-75 [306558] Other proteins in same PDB: d3tiva2, d3tiva3, d3tivb2, d3tivb3 automated match to d3j9tb1 complexed with 1pe, aes, cl, gol, pg0, pg4; mutant |
PDB Entry: 3tiv (more details), 1.75 Å
SCOPe Domain Sequences for d3tiva1:
Sequence, based on SEQRES records: (download)
>d3tiva1 b.49.1.0 (A:12-75) automated matches {Methanosarcina mazei [TaxId: 192952]} agplifvektepvgyneivnikmgdgtvrrgqvldssadivvvqvfegtggldkdcgvif tget
>d3tiva1 b.49.1.0 (A:12-75) automated matches {Methanosarcina mazei [TaxId: 192952]} agplifvektepvgyneivnikmgdgtvrrgqvldssadivvvqvfegviftget
Timeline for d3tiva1: