Lineage for d3rfob1 (3rfo B:1-204)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2500328Fold c.65: Formyltransferase [53327] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 7 strands, order 3214567; strand 6 is antiparallel to the rest
  4. 2500329Superfamily c.65.1: Formyltransferase [53328] (2 families) (S)
  5. 2500447Family c.65.1.0: automated matches [191608] (1 protein)
    not a true family
  6. 2500448Protein automated matches [191110] (11 species)
    not a true protein
  7. 2500454Species Anthrax bacillus (Bacillus anthracis) [TaxId:1392] [226570] (2 PDB entries)
  8. 2500460Domain d3rfob1: 3rfo B:1-204 [306451]
    Other proteins in same PDB: d3rfoa2, d3rfoa3, d3rfob2, d3rfob3, d3rfoc2, d3rfoc3, d3rfod2, d3rfod3
    automated match to d4iqfa1
    complexed with gol, pge, so4

Details for d3rfob1

PDB Entry: 3rfo (more details), 2.4 Å

PDB Description: Crystal Structure of Methyionyl-tRNA Formyltransferase from Bacillus anthracis
PDB Compounds: (B:) Methionyl-tRNA formyltransferase

SCOPe Domain Sequences for d3rfob1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3rfob1 c.65.1.0 (B:1-204) automated matches {Anthrax bacillus (Bacillus anthracis) [TaxId: 1392]}
mikvvfmgtpdfsvpvlrrliedgydvigvvtqpdrpvgrkkvltptpvkveaekhgipv
lqplrirekdeyekvlalepdlivtaafgqivpneileapkygcinvhasllpelrggap
ihyaimegkektgitimymvekldagdiltqveveieerettgslfdklseagahllskt
vplliqgklepikqneeevtfayn

SCOPe Domain Coordinates for d3rfob1:

Click to download the PDB-style file with coordinates for d3rfob1.
(The format of our PDB-style files is described here.)

Timeline for d3rfob1: