Lineage for d1evia1 (1evi A:1-194,A:288-340)

  1. Root: SCOP 1.63
  2. 235644Class c: Alpha and beta proteins (a/b) [51349] (117 folds)
  3. 239983Fold c.4: Nucleotide-binding domain [51970] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 5 strands, order 32145; Rossmann-like
  4. 239984Superfamily c.4.1: Nucleotide-binding domain [51971] (3 families) (S)
    this superfamily shares the common nucleotide-binding site with and provides a link between the Rossmann-fold NAD(P)-binding and FAD/NAD(P)-binding domains
  5. 240035Family c.4.1.2: D-aminoacid oxidase, N-terminal domain [51979] (1 protein)
    This family is probably related to the FAD-linked reductases and shares with them the C-terminal domain fold
  6. 240036Protein D-aminoacid oxidase, N-terminal domain [51980] (2 species)
  7. 240037Species Pig (Sus scrofa) [TaxId:9823] [51981] (6 PDB entries)
  8. 240050Domain d1evia1: 1evi A:1-194,A:288-340 [30629]
    Other proteins in same PDB: d1evia2, d1evib2

Details for d1evia1

PDB Entry: 1evi (more details), 2.5 Å

PDB Description: three-dimensional structure of the purple intermediate of porcine kidney d-amino acid oxidase

SCOP Domain Sequences for d1evia1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1evia1 c.4.1.2 (A:1-194,A:288-340) D-aminoacid oxidase, N-terminal domain {Pig (Sus scrofa)}
mrvvvigagviglstalciheryhsvlqpldvkvyadrftpftttdvaaglwqpytseps
npqeanwnqqtfnyllshigspnaanmgltpvsgynlfreavpdpywkdmvlgfrkltpr
eldmfpdyrygwfntslilegrkylqwlterltergvkfflrkvesfeevarggadviin
ctgvwagvlqpdplXqvrlereqlrfgssntevihnyghggygltihwgcalevaklfgk
vleernll

SCOP Domain Coordinates for d1evia1:

Click to download the PDB-style file with coordinates for d1evia1.
(The format of our PDB-style files is described here.)

Timeline for d1evia1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1evia2