Class f: Membrane and cell surface proteins and peptides [56835] (60 folds) |
Fold f.55: Photosystem II antenna protein-like [161076] (1 superfamily) 6 transmembrane helices arranged in three antiparallel pairs (hairpins), segregated by cofactors; there can be insertions of different small subdomains in different exposed loops |
Superfamily f.55.1: Photosystem II antenna protein-like [161077] (1 family) automatically mapped to Pfam PF00421 |
Family f.55.1.1: Photosystem II antenna protein-like [161078] (3 proteins) Pfam PF00421 |
Protein automated matches [191285] (5 species) not a true protein |
Species Thermosynechococcus vulcanus [TaxId:32053] [189912] (35 PDB entries) |
Domain d3arcb_: 3arc B: [305002] Other proteins in same PDB: d3arca_, d3arcd_, d3arce_, d3arcf_, d3arch_, d3arci_, d3arcj_, d3arck_, d3arcl_, d3arcm_, d3arco_, d3arct_, d3arcu_, d3arcv_, d3arcx_, d3arcz_ automated match to d3wu2b_ complexed with bcr, bct, ca, cl, cla, dgd, fe2, gol, hem, htg, lhg, lmg, lmt, mg, oex, pho, pl9, sqd, unl |
PDB Entry: 3arc (more details), 1.9 Å
SCOPe Domain Sequences for d3arcb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3arcb_ f.55.1.1 (B:) automated matches {Thermosynechococcus vulcanus [TaxId: 32053]} glpwyrvhtvlindpgrliaahlmhtalvagwagsmalyelatfdpsdpvlnpmwrqgmf vlpfmarlgvtgswsgwsitgetgidpgfwsfegvalahivlsgllflaacwhwvywdle lfrdprtgepaldlpkmfgihlflagllcfgfgafhltglfgpgmwvsdpygltgsvqpv apewgpdgfnpynpggvvahhiaagivgiiaglfhilvrppqrlykalrmgnietvlsss iaavffaafvvagtmwygsattpielfgptryqwdssyfqqeinrrvqaslasgatleea wsaipeklafydyignnpakgglfrtgpmnkgdgiaqawkghavfrnkegeelfvrrmpa ffesfpviltdkngvvkadipfrraeskysfeqqgvtvsfyggelngqtftdpptvksya rkaifgeifefdtetlnsdgifrtsprgwftfahavfallfffghiwhgartlfrdvfsg idpelspeqvewgfyqkvgdvttr
Timeline for d3arcb_: