Lineage for d3aeoc_ (3aeo C:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2502820Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
    main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest
  4. 2502821Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) (S)
  5. 2504326Family c.67.1.0: automated matches [191328] (1 protein)
    not a true family
  6. 2504327Protein automated matches [190151] (160 species)
    not a true protein
  7. 2504672Species Entamoeba (Entamoeba histolytica) [TaxId:5759] [311267] (8 PDB entries)
  8. 2504687Domain d3aeoc_: 3aeo C: [304945]
    automated match to d3ri6a_
    complexed with 3lm, gol, so4

Details for d3aeoc_

PDB Entry: 3aeo (more details), 2.15 Å

PDB Description: reaction intermediate structure of entamoeba histolytica methionine gamma-lyase 1 containing methionine alpha, beta-enamine-pyridoxamine- 5'-phosphate
PDB Compounds: (C:) methionine gamma-lyase

SCOPe Domain Sequences for d3aeoc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3aeoc_ c.67.1.0 (C:) automated matches {Entamoeba (Entamoeba histolytica) [TaxId: 5759]}
aqditttllhpkgdhvlhshaypifqtstfcfdstqqgadlfmgkgeghiysrlgnptve
qfeemvcsiegaagsaafgsgmgaissstlaflqkgdhliagdtlygctvslfthwlprf
gievdlidtsdvekvkaawkpntkmvylespanptckvsdikgiavvchergarlvvdat
ftspcflkplelgadialhsvskyinghgdviggvssaktaediatikfyrkdagslmap
mdaflcargmktlpirmqihmenglkvakfleqhekivkvnhpglesfpghdiakkqmtg
ygstflfemksfeaakklmehlkvctlavslgcvdtliehpasmthaavpenimrkqgit
pelvrisvgienvddiiadlkqalelw

SCOPe Domain Coordinates for d3aeoc_:

Click to download the PDB-style file with coordinates for d3aeoc_.
(The format of our PDB-style files is described here.)

Timeline for d3aeoc_: