Lineage for d1gesa2 (1ges A:147-262)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2457625Fold c.3: FAD/NAD(P)-binding domain [51904] (1 superfamily)
    core: 3 layers, b/b/a; central parallel beta-sheet of 5 strands, order 32145; top antiparallel beta-sheet of 3 strands, meander
  4. 2457626Superfamily c.3.1: FAD/NAD(P)-binding domain [51905] (9 families) (S)
  5. 2458195Family c.3.1.5: FAD/NAD-linked reductases, N-terminal and central domains [51943] (15 proteins)
    duplication: both domains have similar folds and functions
    most members of the family contain common C-terminal alpha+beta domain
  6. 2458283Protein Glutathione reductase [51944] (3 species)
  7. 2458284Species Escherichia coli [TaxId:562] [51946] (4 PDB entries)
  8. 2458286Domain d1gesa2: 1ges A:147-262 [30474]
    Other proteins in same PDB: d1gesa3, d1gesb3
    complexed with fad

Details for d1gesa2

PDB Entry: 1ges (more details), 1.74 Å

PDB Description: anatomy of an engineered nad-binding site
PDB Compounds: (A:) glutathione reductase

SCOPe Domain Sequences for d1gesa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gesa2 c.3.1.5 (A:147-262) Glutathione reductase {Escherichia coli [TaxId: 562]}
dipgveygidsdgffalpalpervavvgagyigvelggvinglgakthlfemfdaplpsf
dpmisetlvevmnaegpqlhtnaipkavvkntdgsltleledgrsetvdcliwaig

SCOPe Domain Coordinates for d1gesa2:

Click to download the PDB-style file with coordinates for d1gesa2.
(The format of our PDB-style files is described here.)

Timeline for d1gesa2: