Class b: All beta proteins [48724] (178 folds) |
Fold b.24: Hyaluronate lyase-like, C-terminal domain [49862] (2 superfamilies) sandwich, 10 strands in 2 sheets; "folded meander" |
Superfamily b.24.2: Glycosyl hydrolase family 98 C-terminal domain-like [310597] (2 families) C-terminal half of Pfam PF08307 Slightly different topology from Hyaluronate lyase; contains helical insert |
Family b.24.2.0: automated matches [310667] (1 protein) not a true family |
Protein automated matches [310861] (2 species) not a true protein |
Species Streptococcus pneumoniae [TaxId:406556] [311249] (13 PDB entries) |
Domain d2wmib2: 2wmi B:841-1005 [304594] Other proteins in same PDB: d2wmia1, d2wmib1 automated match to d2wmfa2 |
PDB Entry: 2wmi (more details), 1.9 Å
SCOPe Domain Sequences for d2wmib2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2wmib2 b.24.2.0 (B:841-1005) automated matches {Streptococcus pneumoniae [TaxId: 406556]} yegdifaqkldnrwfvynykvnenvkqtgklkfnslemnvefephtygiferisnglkvn lnnfrtnkdslwsnaqdanqakklpqltkkgaikwieehyikdtqfgekrvtkivlrgid klptihslsgtnnsydqpslnfdqknhmvtitinsngnlefelhf
Timeline for d2wmib2: