Lineage for d2wmha2 (2wmh A:426-589)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2387466Fold b.24: Hyaluronate lyase-like, C-terminal domain [49862] (2 superfamilies)
    sandwich, 10 strands in 2 sheets; "folded meander"
  4. 2387523Superfamily b.24.2: Glycosyl hydrolase family 98 C-terminal domain-like [310597] (2 families) (S)
    C-terminal half of Pfam PF08307
    Slightly different topology from Hyaluronate lyase; contains helical insert
  5. 2387528Family b.24.2.0: automated matches [310667] (1 protein)
    not a true family
  6. 2387529Protein automated matches [310861] (2 species)
    not a true protein
  7. 2387530Species Streptococcus pneumoniae [TaxId:170187] [311251] (2 PDB entries)
  8. 2387531Domain d2wmha2: 2wmh A:426-589 [304590]
    Other proteins in same PDB: d2wmha1
    automated match to d2wmfa2

Details for d2wmha2

PDB Entry: 2wmh (more details), 1.7 Å

PDB Description: crystal structure of the catalytic module of a family 98 glycoside hydrolase from streptococcus pneumoniae tigr4 in complex with the h- disaccharide blood group antigen.
PDB Compounds: (A:) fucolectin-related protein

SCOPe Domain Sequences for d2wmha2:

Sequence, based on SEQRES records: (download)

>d2wmha2 b.24.2.0 (A:426-589) automated matches {Streptococcus pneumoniae [TaxId: 170187]}
yegdgyaqrvgnswyiynsnaninknqqvmlpmytnntkslsldltphtyavvkenpnnl
hillnnyrtdktamwalsgnfdaskswkkeelelanwisknysinpvdndfrtttltlkg
htghkpqinisgdknhytytenwdenthvytitvnhngmvemsi

Sequence, based on observed residues (ATOM records): (download)

>d2wmha2 b.24.2.0 (A:426-589) automated matches {Streptococcus pneumoniae [TaxId: 170187]}
yegdgyaqrvgnswyiynsnaninknqqvmlpmytnntkslsldltphtyavvkenpnnl
hillnnyrtdktamwalsgnfdaskswkkeelelanwisknysinpvdndfrtttltlkg
hhkpqinisgdknhytytenwdenthvytitvnhngmvemsi

SCOPe Domain Coordinates for d2wmha2:

Click to download the PDB-style file with coordinates for d2wmha2.
(The format of our PDB-style files is described here.)

Timeline for d2wmha2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2wmha1