Lineage for d2vfva2 (2vfv A:180-417)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2555938Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2562051Superfamily d.58.32: FAD-linked oxidases, C-terminal domain [55103] (7 families) (S)
    duplication: contains two subdomains of this fold
  5. 2562150Family d.58.32.6: Alditol oxidase [310621] (1 protein)
    Pfam PF04030; PubMed 18154360
  6. 2562151Protein Alditol oxidase [310716] (1 species)
  7. 2562152Species Streptomyces coelicolor [TaxId:100226] [310961] (5 PDB entries)
  8. 2562156Domain d2vfva2: 2vfv A:180-417 [304546]
    Other proteins in same PDB: d2vfva1
    automated match to d2vfra1
    complexed with cl, sfd

Details for d2vfva2

PDB Entry: 2vfv (more details), 1.72 Å

PDB Description: alditol oxidase from streptomyces coelicolor a3(2): complex with sulphite
PDB Compounds: (A:) xylitol oxidase

SCOPe Domain Sequences for d2vfva2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2vfva2 d.58.32.6 (A:180-417) Alditol oxidase {Streptomyces coelicolor [TaxId: 100226]}
yemeqhvftelplagldpatfetvmaaaysvslftdwrapgfrqvwlkrrtdrpldgfpy
aapaaekmhpvpgmpavncteqfgvpgpwherlphfraeftpssgaelqseylmprehal
aalhamdairetlapvlqtceirtvaadaqwlspaygrdtvaahftwvedtaavlpvvrr
leealvpfaarphwgkvftvpagelralyprladfgalagaldpagkftnafvrgvla

SCOPe Domain Coordinates for d2vfva2:

Click to download the PDB-style file with coordinates for d2vfva2.
(The format of our PDB-style files is described here.)

Timeline for d2vfva2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2vfva1