Lineage for d2kema_ (2kem A:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2525733Fold c.97: Cytidine deaminase-like [53926] (2 superfamilies)
    core: alpha-beta(2)-(alpha-beta)2; 3 layers (a/b/a); mixed beta-sheet of 4 strands, order 2134; strand 1 is antiparallel to the rest
  4. 2525734Superfamily c.97.1: Cytidine deaminase-like [53927] (7 families) (S)
    contains extra C-terminal strand 5, order 21345
  5. 2525970Family c.97.1.6: apolipoprotein B messenger RNA-editing enzyme catalytic (APOBEC) cytidine deaminase domains [310632] (5 proteins)
    strand 5 is parallel to strand 4
    Pfam PF08210; Pfam PF05240
  6. 2525996Protein APOBEC3G (ARCD) [310757] (2 species)
  7. 2525997Species Human (Homo sapiens) [TaxId:9606] [311012] (2 PDB entries)
  8. 2525999Domain d2kema_: 2kem A: [304163]
    automated match to d2nytb_
    complexed with zn

Details for d2kema_

PDB Entry: 2kem (more details)

PDB Description: extended structure of citidine deaminase domain of apobec3g
PDB Compounds: (A:) DNA dC->dU-editing enzyme APOBEC-3G

SCOPe Domain Sequences for d2kema_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2kema_ c.97.1.6 (A:) APOBEC3G (ARCD) {Human (Homo sapiens) [TaxId: 9606]}
eilrhsmdpptftfnfnnepwvrgrhetylcyevermhndtwvklnqrrgflanqaphkh
gflegrhaelcfldvipfwkldldqdyrvtcftswspcfscaqemakfisknkhvslcik
tariyddqgraqeglrtlaeagakisimtysefkhcwdtfvdhqgapfqpwdgldehsqd
lsgrlrailqnqen

SCOPe Domain Coordinates for d2kema_:

Click to download the PDB-style file with coordinates for d2kema_.
(The format of our PDB-style files is described here.)

Timeline for d2kema_: