SCOP 1.61: Domain d1f8sc1: 1f8s C:5-319,C:433-486

Lineage for d1f8sc1 (1f8s C:5-319,C:433-486)

1. Root: SCOP 1.61

2. Class c: Alpha and beta proteins (a/b) [51349] (117 folds)

3. Fold c.3: FAD/NAD(P)-binding domain [51904] (1 superfamily)

4. Superfamily c.3.1: FAD/NAD(P)-binding domain [51905] (5 families)

5. Family c.3.1.2: FAD-linked reductases, N-terminal domain [51913] (8 proteins)

6. Protein L-amino acid oxidase [51929] (1 species)

7. Species Malayan pit viper (Calloselasma rhodostoma) [TaxId:8717] [51930] (2 PDB entries)

8. Domain d1f8sc1: 1f8s C:5-319,C:433-486 [30416]
   Other proteins in same PDB: d1f8sa2, d1f8sb2, d1f8sc2, d1f8sd2, d1f8se2, d1f8sf2, d1f8sg2, d1f8sh2

Details for d1f8sc1

PDB Entry: 1f8s, 2 Å

PDB Description: crystal structure of l-amino acid oxidase from calloselasma rhodostoma, complexed with three molecules of o-aminobenzoate.

SCOP Domain Sequences for d1f8sc1:

Sequence; same for both SEQRES and ATOM records:

>d1f8sc1 c.3.1.2 (C:5-319,C:433-486) L-amino acid oxidase {Malayan pit viper (Calloselasma rhodostoma)}
nplaecfqendyeefleiarnglkatsnpkhvvivgagmaglsaayvlagaghqvtvlea
serpggrvrtyrneeagwyanlgpmrlpekhrivreyirkfdlrlnefsqendnawyfik
nirkkvgevkkdpgllkypvkpseagksagqlyeeslgkvveelkrtncsyilnkydtys
tkeylikegdlspgavdmigdllnedsgyyvsfieslkhddifayekrfdeivdgmdklp
tamyrdiqdkvhfnaqvikiqqndqkvtvvyetlsketpsvtadyvivcttsravrlikf
nppllpkkahalrsvXftpyqfqhfsdpltasqgriyfageytaqahgwidstiksglra
ardvnlasen

Timeline for d1f8sc1:

• d1f8sc1 first appeared (with stable ids) in SCOP 1.55
  
• d1f8sc1 appears in SCOP 1.59
  
• d1f8sc1 appears in SCOP 1.63
  
• d1f8sc1 appears in the current release, SCOPe 2.08