SCOPe 2.07: Domain d2j2td1: 2j2t D:2-370

Lineage for d2j2td1 (2j2t D:2-370)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.126: Pentein, beta/alpha-propeller [55908] (1 superfamily)
   duplication: composed of 5 alpha-beta(2)-alpha-beta units arranged around pseudo fivefold axis

4. Superfamily d.126.1: Pentein [55909] (8 families)

5. Family d.126.1.6: Porphyromonas-type peptidylarginine deiminase [111155] (3 proteins)
   Pfam PF04371; functionally related to the amidinotransferase, similar active site

6. Protein automated matches [190353] (3 species)
   not a true protein

7. Species Enterococcus faecalis [311217] (1 PDB entry)

8. Domain d2j2td1: 2j2t D:2-370 [304097]
   Other proteins in same PDB: d2j2td2
   automated match to d2jerd_

Details for d2j2td1

PDB Entry: 2j2t, 1.65 Å

PDB Description: agmatine deiminase from enterococcus faecalis covalently linked with a reaction intermediate

PDB Compounds: (D:) agmatine deiminase

SCOPe Domain Sequences for d2j2td1:

Sequence; same for both SEQRES and ATOM records:

>d2j2td1 d.126.1.6 (D:2-370) automated matches {Enterococcus faecalis}
akrivgstpkqdgfrmpgefepqekvwmiwperpdnwrdggkpvqeaftnvakaisqftp
mnvvvsqqqfqncrrqlppeitvyemsnndawvrdcgpsfvindhgeirgvdwtfnawgg
lvdglyfpwdqddlvaqkiceiehvdsyrtddfvleggsfhvdgqgtvlttemcllsegr
npqlskeaieqklcdylnvekvlwlgdgidpeetnghvddvacfiapgevaciytedqns
pfyeaaqdayqrllkmtdakgrqlkvhklccpvknvtikgsfkidfvegtmpredgdici
asymnflitndgvivpqygdendhlaleqvqtmfpdkkivgvntvevvygggnihxitqq
epkrvggkq

Timeline for d2j2td1:

• d2j2td1 first appeared in SCOPe 2.06, called d2j2td_
  
• d2j2td1 appears in the current release, SCOPe 2.08