Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.95: Thiolase-like [53900] (1 superfamily) consists of two similar domains related by pseudo dyad; duplication 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest |
Superfamily c.95.1: Thiolase-like [53901] (3 families) |
Family c.95.1.1: Thiolase-related [53902] (10 proteins) |
Protein Ketosynthase domain from 6-deoxyerythronolide B synthase (DEBS) [310768] (1 species) |
Species Saccharopolyspora erythraea [TaxId:1836] [311024] (1 PDB entry) |
Domain d2hg4c2: 2hg4 C:37-275 [303984] Other proteins in same PDB: d2hg4a1, d2hg4a4, d2hg4a5, d2hg4a6, d2hg4a7, d2hg4b1, d2hg4b4, d2hg4b5, d2hg4b6, d2hg4b7, d2hg4c1, d2hg4c4, d2hg4c5, d2hg4c6, d2hg4c7, d2hg4d1, d2hg4d4, d2hg4d5, d2hg4d6, d2hg4d7, d2hg4e1, d2hg4e4, d2hg4e5, d2hg4e6, d2hg4e7, d2hg4f1, d2hg4f4, d2hg4f5, d2hg4f6, d2hg4f7 complexed with act, cl, so4 |
PDB Entry: 2hg4 (more details), 2.73 Å
SCOPe Domain Sequences for d2hg4c2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2hg4c2 c.95.1.1 (C:37-275) Ketosynthase domain from 6-deoxyerythronolide B synthase (DEBS) {Saccharopolyspora erythraea [TaxId: 1836]} agepiaivgmacrfpgdvdspesfwefvsgggdaiaeapadrgwepdpdarlggmlaaag dfdagffgisprealamdpqqrimleiswealeraghdpvslrgsatgvftgvgtvdygp rpdeapdevlgyvgtgtassvasgrvayclglegpamtvdtacssgltalhlameslrrd ecglalaggvtvmsspgaftefrsqgglaadgrckpfskaadgfglaegagvlvlqrls
Timeline for d2hg4c2:
View in 3D Domains from other chains: (mouse over for more information) d2hg4a1, d2hg4a2, d2hg4a3, d2hg4a4, d2hg4a5, d2hg4a6, d2hg4a7, d2hg4b1, d2hg4b2, d2hg4b3, d2hg4b4, d2hg4b5, d2hg4b6, d2hg4b7, d2hg4d1, d2hg4d2, d2hg4d3, d2hg4d4, d2hg4d5, d2hg4d6, d2hg4d7, d2hg4e1, d2hg4e2, d2hg4e3, d2hg4e4, d2hg4e5, d2hg4e6, d2hg4e7, d2hg4f1, d2hg4f2, d2hg4f3, d2hg4f4, d2hg4f5, d2hg4f6, d2hg4f7 |