Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.31: DHS-like NAD/FAD-binding domain [52466] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456; Rossmann-like |
Superfamily c.31.1: DHS-like NAD/FAD-binding domain [52467] (7 families) binds cofactor molecules in the opposite direction than classical Rossmann fold |
Family c.31.1.0: automated matches [191352] (1 protein) not a true family |
Protein automated matches [190312] (14 species) not a true protein |
Species Milk yeast (Kluyveromyces lactis) [TaxId:28985] [255612] (3 PDB entries) |
Domain d2g1id2: 2g1i D:182-360 [303918] Other proteins in same PDB: d2g1ia1, d2g1ia3, d2g1ib1, d2g1ib3, d2g1ic1, d2g1ic3, d2g1id1, d2g1id3 automated match to d2vk4a2 complexed with mg, tpp |
PDB Entry: 2g1i (more details), 2.26 Å
SCOPe Domain Sequences for d2g1id2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2g1id2 c.31.1.0 (D:182-360) automated matches {Milk yeast (Kluyveromyces lactis) [TaxId: 28985]} dtpidlslkpndpeaeeevienvlqlikeaknpviladaccsrhdakaetkklidltqfp afvtpmgkgsidekhprfggvyvgtlsspavkeavesadlvlsvgallsdfntgsfsysy ktknivefhsdytkirsatfpgvqmkfalqklltkvadaakgykpvpvpsepehneava
Timeline for d2g1id2: